ORB594750
Human TGFB2 protein

Cannot supply to this region.
- SKU:
- ORB594750
- Additional Names:
- Transforming growth factor beta-2;TGFB2;Polyergin;G-TSF;Glioblastoma-derived T-cell suppressor factor;Cetermin;BSC-1 cell growth inhibitor;TGF-beta-2
- Molecular Weight:
- 12.7 kDa
- Purity:
- Greater than 95% as determined by SDS-PAGE.
- Source:
- Mammalian cell
- Research Area:
- Cancer Biology
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 μm filtered 4 mM HCl
- Format:
- Lyophilized powder
- Sequence:
- ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
- Shipping Conditions:
- Blue Ice
