Human FGF2 protein

Cannot supply to this region.

SKU:: ORB594738
Additional Names:: Fibroblast growth factor 2;FGF-2;Basic fibroblast growth factor;bFGF;Heparin-binding growth factor 2;HBGF-2
Molecular Weight:: 16.3 kDa
Purity:: Greater than 95% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Cardiovascular Research
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: Lyophilized from a 0.2 μm filtered 20mM Tris-Hcl, 250mM NaCl, pH 7.5.
Format:: Lyophilized powder
Sequence:: PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS