ORB594736
Human PDGF B protein
Cannot supply to this region.
- SKU:
- ORB594736
- Additional Names:
- Platelet-Derived Growth Factor Subunit B; PDGF Subunit B; PDGF-2; Platelet-Derived Growth Factor B Chain; Platelet-Derived Growth Factor Beta Polypeptide; Proto-Oncogene c-Sis; Becaplermin; PDGFB; PDGF2; SIS
- Molecular Weight:
- 12.42 kDa
- Purity:
- Greater than 98% as determined by SDS-PAGE.
- Source:
- E.coli
- Research Area:
- Cancer Biology
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 μm filtered solution of 20mM NaAc-HAc, pH 4.5.
- Format:
- Lyophilized powder
- Sequence:
- SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
- Shipping Conditions:
- Blue Ice