Human NGF protein

Cannot supply to this region.

SKU:: ORB594731
Additional Names:: Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB
Molecular Weight:: 13.4 kDa
Purity:: Greater than 95% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Neuroscience
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: Lyophilized from a 0.2 μm sterile filtered PBS, pH 7.4.
Format:: Lyophilized powder
Sequence:: SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA