Human KITLG protein

Cannot supply to this region.

SKU:: ORB594728
Additional Names:: Kit Ligand; Mast Cell Growth Factor; MGF; Stem Cell Factor; SCF; c-Kit ligand; KITLG; MGF; SCF
Molecular Weight:: 18.4 kDa
Purity:: Greater than 95% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Immunology & Inflammation
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.0
Format:: Lyophilized powder
Sequence:: EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA