ORB594725
Human EGF protein

Cannot supply to this region.
- SKU:
- ORB594725
- Additional Names:
- Pro-Epidermal Growth Factor; EGF; Epidermal Growth Factor; Urogastrone
- Molecular Weight:
- 6.2 kDa
- Purity:
- Greater than 95% as determined by SDS-PAGE.
- Source:
- E.coli
- Research Area:
- Cancer Biology
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 200 mM NaCl, pH 8.0
- Format:
- Lyophilized powder
- Sequence:
- NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
- Shipping Conditions:
- Blue Ice
