ORB583248
RBBP4 Rabbit Polyclonal Antibody

Cannot supply to this region.
- SKU:
- ORB583248
- Additional Names:
- NURF55, RBAP48, lin-53
- Application:
- WB
- Concentration:
- 0.5 mg/ml
- Molecular Weight:
- 48kDa
- Research Area:
- Epigenetics & Chromatin
- Storage Conditions:
- Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
- Supplier:
- Biorbyt
- Host:
- Rabbit
- Reactivities:
- Human
- Buffer:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Sequence:
- Synthetic peptide located within the following region: HTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK
- Gene Details:
- NP_005601
- Shipping Conditions:
- Blue Ice
