Human RALB protein

Cannot supply to this region.

SKU:: ORB54437
Additional Names:: 5730472O18Rik, dRalb, GTP binding protein, Ralb, RALB_HUMAN, RAS like protein B, RAS like proto oncogene B, Ras related GTP binding protein B, Ras-related protein Ral-B, v ral simian leukemia viral oncogene homolog B (ras related GTP binding protein), v ral simian leukemia viral oncogene homolog B (ras related), V ral simian leukemia viral oncogene homolog B
Molecular Weight:: 50.1 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Cell Biology
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERC