Human CLTA protein

Cannot supply to this region.

SKU:: ORB54360
Additional Names:: Clathrin light chain A, Clathrin light chain B, Clathrin light chain LCA, Clathrin light chain LCB, Clathrin light polypeptide A, Clathrin light polypeptide, Clathrin light polypeptide B, Clathrin light polypeptide LCA, Clathrin light polypeptide LCB, Clathrin, light chain (Lcb), Clathrin, light polypeptide (Lca), Clathrin, light polypeptide (Lcb), CLCA_HUMAN, CLTA, CLTB, Lca, LCB
Molecular Weight:: 50.7 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Neuroscience
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH