Human ATP5J protein

Cannot supply to this region.

SKU:: ORB54327
Additional Names:: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6, ATP synthase-coupling factor 6, mitochondrial, ATP synthase-coupling factor 6, mitochondrial, ATP5, ATP5A, ATP5J, ATP5J_HUMAN, ATPase subunit F6, ATPM, CF6, F6
Molecular Weight:: 36 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Disease Biomarkers
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: NKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA