Human PRKAB2 protein

Cannot supply to this region.

SKU:: ORB54263
Additional Names:: 5' AMP activated protein kinase beta 2 subunit, 5' AMP activated protein kinase subunit beta 2, 5''-AMP-activated protein kinase subunit beta-2, AAKB2_HUMAN, AMP activated protein kinase beta 2 non catalytic subunit, AMPK beta 2, AMPK beta 2 chain, AMPK subunit beta 2, AMPK subunit beta-2, MGC61468, PRKAB 2, Prkab2, Protein kinase AMP activated beta 2 non catalytic subunit
Molecular Weight:: 57.3 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Signal Transduction
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI