ORB54039
Human Angiotensinogen protein
Cannot supply to this region.
- SKU:
- ORB54039
- Additional Names:
- Aangiotensinogen (serpin peptidase inhibitor clade A member 8) Proteins, AGT Proteins, AI265500 Proteins, Alpha 1 antiproteinase antitrypsin Proteins, Ang Proteins, Ang I Proteins, Ang II Proteins, Ang III Proteins, AngII Proteins, Angiotensin I Proteins, Angiotensin II Proteins, Angiotensin III Proteins, Angiotensin-3 Proteins, Angiotensinogen (PAT) Proteins, Angiotensinogen Proteins, ANGT_HUMAN Proteins, ANHU Proteins, ANRT Proteins, AT-2 Proteins, AT-II Proteins, Des-Asp[1]-angiotensin II Proteins, FLJ92595 Proteins, FLJ97926 Proteins, MGC105326 Proteins, PAT Proteins, Pre angiotensinogen Proteins, Serine (or cysteine) proteinase inhibitor Proteins, Serpin A8 Proteins, Serpin peptidase inhibitor clade A member 8 Proteins, SERPINA8 Proteins
- Molecular Weight:
- 57.9 kDa
- Purity:
- Greater than 90% as determined by SDS-PAGE.
- Source:
- E.coli
- Research Area:
- Cardiovascular Research
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Format:
- Liquid or Lyophilized powder
- Sequence:
- VIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNS
- Shipping Conditions:
- Blue Ice