ORB419321
Human IL12A protein
Cannot supply to this region.
- SKU:
- ORB419321
- Additional Names:
- IL-12A, CLMF p35, IL-12 subunit p35, NK cell stimulatory factor chain 1, NKSF1
- Molecular Weight:
- 57.2 kDa. 75.0 kDa is the observed value of non-reducing gel,and the reducing glue is the size of p40 and p35 subunits, and 57.2 kDa is the theoretical value.
- Purity:
- > 95% as determined by SDS-PAGE and HPLC.
- Source:
- Baculovirus
- Research Area:
- Immunology & Inflammation
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 µm filtered PBS, pH 7.4
- Format:
- Lyophilized powder
- Sequence:
- p35Subunit:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASp40Subunit:IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
- Shipping Conditions:
- Blue Ice