ORB419318
Human VEGFA protein
Cannot supply to this region.
- SKU:
- ORB419318
- Additional Names:
- VEGF-A, VPF
- Molecular Weight:
- 19.3 kDa
- Purity:
- > 97% as determined by SDS-PAGE and HPLC.
- Source:
- Yeast
- Research Area:
- Cardiovascular Research; Cell Biology
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.02 % Tween-20
- Format:
- Lyophilized powder
- Sequence:
- M+APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
- Shipping Conditions:
- Blue Ice