Viral GPC protein

Cannot supply to this region.

SKU:: ORB419255
Additional Names:: GPC, GP-C, Segment, SPre-glycoprotein polyprotein GP complex, Pre-GP-C) [Cleaved into, Stable signal peptide, SSP), Glycoprotein G1, GP1), Glycoprotein G2, GP2)]
Molecular Weight:: 24.9 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: in vitro E.coli expression system
Research Area:: Infectious Disease & Virology; Immunology & Inflammation
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: ALPHIIDEVINIVIIVLIVITGIKAVYNFATCGIFALISFLLLAGRSCGMYGLKGPDIYKGVYQFKSVEFDMSHLNLTMPN