Human PRLR protein

Cannot supply to this region.

SKU:: ORB419243
Additional Names:: AI987712, CLONE SPM213, CPRLP, Delta 4-delta 7/11 truncated prolactin receptor , Delta 4-SF1b truncated prolactin receptor , HPRL, hPRL receptor, hPRLrI, Lactogen receptor, MFAB, MGC105486, OPR, OTTHUMP00000115998 , Pr-1, Pr-3, PRL R, PRL-R, PRLR, Prlr-rs1, PRLR_HUMAN, Prolactin receptor a, Prolactin receptor, Prolactin receptor delta 7/11 , RATPRLR, Secreted prolactin binding protein , Truncated testis-specific box 1-C prolactin receptor , wu, fj65c07
Molecular Weight:: 71.9 kDa
Purity:: Greater than 85% as determined by SDS-PAGE.
Source:: in vitro E.coli expression system
Research Area:: Signal Transduction
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: QLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH

Shipping Conditions:: Blue Ice