ORB419139
Human Genome poly protein

Cannot supply to this region.
- SKU:
- ORB419139
- Additional Names:
- Genome polyprotein [Cleaved into, P1, Capsid protein VP0, VP4-VP2), Capsid protein VP4, P1A, Virion protein 4), Capsid protein VP2, P1B, Virion protein 2), Capsid protein VP3, P1C, Virion protein 3), Capsid protein VP1, P1D, Virion protein 1), P2, Protease 2A, P2A, EC 3.4.22.29, Picornain 2A, Protein 2A), Protein 2B, P2B), Protein 2C, P2C, EC 3.6.1.15), P3, Protein 3AB, Protein 3A, P3A), Viral protein genome-linked, VPg, Protein 3B, P3B), Protein 3CD, EC 3.4.22.28), Protease 3C, EC 3.4.22.28, Picornain 3C, P3C), RNA-directed RNA polymerase, RdRp, EC 2.7.7.48, 3D polymerase, 3Dpol, Protein 3D, 3D)]
- Molecular Weight:
- 38.1 kDa
- Purity:
- Greater than 85% as determined by SDS-PAGE.
- Source:
- E.coli
- Research Area:
- Epigenetics, Infectious Diseases, Non-Animal
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Format:
- Liquid or Lyophilized powder
- Sequence:
- NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRPPRAVAYQHTHSTNYIPSNGEATTQIKTRPDVFTVTNV
- Shipping Conditions:
- Blue Ice
