ORB383404
Human COPS2 protein
Cannot supply to this region.
- SKU:
- ORB383404
- Additional Names:
- anti ALIENprotein, anti Alien Drosophila himolog ofprotein, anti Alien homologprotein, anti COP 9protein, anti COP9protein, anti COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis)protein, anti COP9 constitutive photomorphogenic homolog subunit 2protein, anti COP9 signalosome complex subunit 2protein, anti COPS 2protein, anti Cops2protein, anti JAB1 containing signalosome subunit 2protein, anti JAB1-containing signalosome subunit 2protein, anti SGN 2protein, anti SGN2protein, anti Signalosome subunit 2protein, anti Thyroid Hormone Receptor Interactor15protein, anti Thyroid Hormone Receptor Interactor 15protein, anti Thyroid receptor-interacting protein 15protein, anti TR-interacting protein 15protein, anti TRIP 15protein, anti TRIP-15protein, anti TRIP15protein
- Molecular Weight:
- 67.6 kDa
- Purity:
- Greater than 90% as determined by SDS-PAGE.
- Source:
- E.coli
- Research Area:
- Signal Transduction
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Format:
- Liquid or Lyophilized powder
- Sequence:
- MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA
- Shipping Conditions:
- Blue Ice