ORB383389
Insect alpha 1 Antitrypsin protein
Cannot supply to this region.
- SKU:
- ORB383389
- Additional Names:
- anti A1Aprotein, anti A1ATprotein, anti AATprotein, anti Alpha 1 antitrypsinprotein, anti Alpha1ATprotein, anti Dom1protein, anti PI1protein, anti PRO2275protein, anti Serpin A1protein, anti Serpin A1aprotein, anti Serpina1protein, anti Short peptide from AATprotein, anti SPAATprotein, anti Spi1-1protein
- Molecular Weight:
- 24.7 kDa
- Purity:
- Greater than 90% as determined by SDS-PAGE.
- Source:
- E.coli
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Format:
- Liquid or Lyophilized powder
- Sequence:
- GLVGAPATLSTAPIAYGGYGGYGAYGGSLLRAAPIARVASPLAYAAPVARVAAPLAYAAPYARAAVAAPVAVAKTVVADEYDPNPQYSFGYDVQDGLTGDSKNQVESRSGDVVQGSYSLVDPDGTRRTVEYTADPINGFNAVVHREPLVAKAVVAAPAIAKVHAPLAYSGGYLH
- Shipping Conditions:
- Blue Ice