ORB383387
Human PPP1CB protein
Cannot supply to this region.
- SKU:
- ORB383387
- Additional Names:
- MGC3672, PP 1B , PP-1B, PP1B, PP1B_HUMAN, PP1beta, PPP1CB, PPP1CD, Protein phosphatase 1 beta, Protein phosphatase 1 catalytic subunit beta isoform, Protein phosphatase 1 delta, Protein phosphatase 1, catalytic subunit, beta isozyme, Protein phosphatase 1, catalytic subunit, delta isoform, Serine threonine protein phosphatase PP1 beta catalytic subunit, Serine/threonine-protein phosphatase PP1-beta catalytic subunit
- Molecular Weight:
- 41.1 kDa
- Purity:
- Greater than 90% as determined by SDS-PAGE.
- Source:
- E.coli
- Research Area:
- Signal Transduction
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Format:
- Liquid or Lyophilized powder
- Sequence:
- ADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
- Shipping Conditions:
- Blue Ice