Mouse GP73 protein

Cannot supply to this region.

SKU:: ORB383325
Additional Names:: anti Golgi membrane protein 1protein, anti Golgi membrane protein GP73protein, anti Golgi phosphoprotein 2protein, anti Golgi protein 73 kDprotein, anti golgi protein 73kDprotein, anti GOLM 1protein, anti GOLM1protein, anti GOLPH 2protein, anti GOLPH2protein, anti GP 73protein, anti GP73protein
Molecular Weight:: 56.6 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Signal Transduction
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: SSRSVELQTRIVELEGRVRRAAAERGAVELKKNEFQGELQKQREQLDRIQSSHSFQLENVNKLHQDEKAVLVNNITTGEKLIRDLQDQLKALQRSYSSLQQDIFQFQKNQTSLEKKFSYDLNQCISQMTEVKEQCDERIEEVIRKRNEAPGSRDLAETNNQHQQALKPQPKLQEEVPSEEQMPQEKGDVPRNKSQIPAPNSESLGLKPQVQNEETNEIQAVGEEHQQASIQGQAVADGTRVGAEKLDQHTQLPAGLLARPEEDSQYPEREQLVIRDRQEQQRASEEGGGQKNPGDEYDMDENEAESEREKQAALAGNDRNINVLNADAQKRGIINVPVGSERQSHILNQVGIHIPQQA