Human CD35 protein

Cannot supply to this region.

SKU:: ORB383319
Additional Names:: anti C3 binding proteinprotein, anti C3b/C4b receptorprotein, anti C3BRprotein, anti C4BRprotein, anti CD 35protein, anti CD35protein, anti CD35 antigenprotein, anti complement component (3b/4b) receptor 1 (Knops blood group)protein, anti complement component (3b/4b) receptor 1 including Knops blood group systemprotein, anti Complement component receptor 1protein, anti Complement receptor 1protein, anti Complement receptor type 1protein, anti CR 1protein, anti CR1protein
Molecular Weight:: 48.4 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Immunology & Inflammation
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: GQCNAPEWLPFARPTNLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCII