ORB383281
Human CD3E protein
Cannot supply to this region.
- SKU:
- ORB383281
- Additional Names:
- FLJ18683 Proteins, T3E Proteins, TCRE Proteins, CD3E Proteins, CD3-epsilon Proteins, CD3 epsilon Proteins, CD3E Proteins, CD3E antigen epsilon polypeptide (TiT3 complex) Proteins, CD3E antigen epsilon polypeptide Proteins, CD3E antigen Proteins, epsilon subunit Proteins, CD3E molecule epsilon Proteins, CD3E molecule Proteins, epsilon (CD3 TCR complex) Proteins, CD3E molecule Proteins, epsilon (CD3-TCR complex) Proteins, CD3E_HUMAN Proteins, IMD18 Proteins, T cell antigen receptor complex epsilon subunit of T3 Proteins, T cell surface antigen T3/Leu 4 epsilon chain Proteins, T cell surface glycoprotein CD3 epsilon chain Proteins, T-cell surface antigen T3/Leu-4 epsilon chain Proteins, T-cell surface glycoprotein CD3 epsilon chain Proteins, T3E Proteins, TCRE Proteins
- Molecular Weight:
- 13.8 kDa
- Purity:
- Greater than 90% as determined by SDS-PAGE.
- Source:
- Yeast
- Research Area:
- Immunology & Inflammation
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Format:
- Liquid or Lyophilized powder
- Sequence:
- DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
- Shipping Conditions:
- Blue Ice