Human AMELX protein

Cannot supply to this region.

SKU:: ORB383242
Additional Names:: AI1E, AIH1, ALGN, Amel, Amelogenesis imperfecta 1, Amelogenin (amelogenesis imperfecta 1, X linked), Amelogenin (X chromosome), Amelogenin (X chromosome, amelogenesis imperfecta 1), Amelogenin, Amelogenin X isoform, Amelogenin, X linked, AMELX, AMELX_HUMAN, Amg, AMGL, AMGX, OTTHUMP00000022906, OTTHUMP00000022907, X isoform
Molecular Weight:: 35.9 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Signal Transduction
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: MPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD