ORB383238
Monkey Mast Cell Chymase protein
Cannot supply to this region.
- SKU:
- ORB383238
- Additional Names:
- anti Alpha-chymaseprotein, anti Chymase 1protein, anti Chymase 1 mast cellprotein, anti chymase 1 preproprotein transcript Eprotein, anti chymase 1 preproprotein transcript Iprotein, anti Chymaseprotein, anti Chymase, heartprotein, anti Chymase, mast cellprotein, anti CMA1protein, anti CYHprotein, anti CYMprotein, anti Mast cell chymase 1protein, anti Mast cell protease 3protein, anti Mast cell protease 5protein, anti Mast cell protease Iprotein, anti Mast cell protease IIIprotein, anti Mcp-5protein, anti MCP3Pprotein, anti Mcpt5protein, anti MCT1protein
- Molecular Weight:
- 41.1 kDa
- Purity:
- Greater than 90% as determined by SDS-PAGE.
- Source:
- E.coli
- Research Area:
- Epigenetics
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Format:
- Liquid or Lyophilized powder
- Sequence:
- IIGGTECKPHSRPYMAYLEIVTSNGPSKSCGGFLIRRNFVLTAVHCAGRSITVTLGAHNITEKEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRYFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRLDAKPPAVFTRISHYRPWINKILQAN
- Shipping Conditions:
- Blue Ice