Human MED1 protein

Cannot supply to this region.

SKU:: ORB383234
Additional Names:: Activator-recruited cofactor 205KDA component Short name, ARC205 Mediator complex subunit 1 Peroxisome proliferator-activated receptor-binding protein Short name, PBP Short name, PPAR-binding protein Thyroid hormone receptor-associated protein complex 220KDA component Short name, Trap220 Thyroid receptor-interacting protein 2 Short name, TR-interacting protein 2 Short name, TRIP-2 Vitamin D receptor-interacting protein complex component DRIP205 p53 regulatory protein RB18A
Molecular Weight:: 32.2 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Epigenetics & Chromatin
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: FGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPF