Mouse Transthyretin protein

Cannot supply to this region.

SKU:: ORB383093
Additional Names:: anti Amyloidosis Iprotein, anti ATTRprotein, anti CTSprotein, anti CTS1protein, anti HEL111protein, anti HsT2651protein, anti PALBprotein, anti Prealbumin amyloidosis type Iprotein, anti TBPAprotein, anti Transthyretinprotein, anti TTRprotein, anti TTR proteinprotein
Molecular Weight:: 15.6 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: Yeast
Research Area:: Neuroscience
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN