Rat Dpp4 protein

Cannot supply to this region.

SKU:: ORB383085
Additional Names:: Bile canaliculus domain-specific membrane glycoprotein Dipeptidyl peptidase IV Short name, DPP IV GP110 glycoprotein T-cell activation antigen CD26 CD_antigen, CD26 Cleaved into the following 3 chains, Dipeptidyl peptidase 4 membrane form Alternative name(s), Dipeptidyl peptidase IV membrane form Dipeptidyl peptidase 4 soluble form Alternative name(s), Dipeptidyl peptidase IV soluble form Dipeptidyl peptidase 4 60KDA soluble form Alternative name(s), Dipeptidyl peptidase IV 60KDA soluble form
Molecular Weight:: 30.7 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Immunology & Inflammation
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: SMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDAGVDFQAMWYTDEDHGIASSTAHQHIYSHMSHFLQQCFSLR