Human OGN protein

Cannot supply to this region.

SKU:: ORB383003
Additional Names:: Corneal keratan sulfate proteoglycan; DKFZP586P2421; MIME_HUMAN; Mimecan; Mimecan proteoglycan; OG; OGN; OIF; Osteoglycin; Osteoinductive factor; SLRR3A
Molecular Weight:: 33.7 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: Yeast
Research Area:: Signal Transduction
Storage Conditions:: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid: Tris/PBS-based buffer, 5%-50% glycerol.
Sequence:: PPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKSLQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKE SAYLYARFNKIKKLTAKDFADIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFKKLNNLTFLYLDH NALESVPLNLPESLRVIHLQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLGKHPNSFICLKRLPIGSYF