ORB359286
Human D104A protein (Active)
Cannot supply to this region.
- SKU:
- ORB359286
- Additional Names:
- Beta-defensin 4, DEFB-4, hBD-4, Defensin, beta 104,
- Molecular Weight:
- 6.0 kDa
- Purity:
- > 98% as determined by SDS-PAGE and HPLC.
- Source:
- E.Coli
- Research Area:
- Microbiology
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 130 mM NaCl
- Format:
- Lyophilized powder
- Sequence:
- EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP
- Shipping Conditions:
- Blue Ice