ORB359284
Human DFB4A protein (Active)

Cannot supply to this region.
- SKU:
- ORB359284
- Additional Names:
- Beta-defensin 2, hBD-2, Defensin, beta 2, Skin-antimicrobial peptide 1, SAP1
- Molecular Weight:
- 4.3 kDa
- Purity:
- > 98% as determined by SDS-PAGE and HPLC.
- Source:
- E.Coli
- Research Area:
- Microbiology
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 130 mM NaCl
- Format:
- Lyophilized powder
- Sequence:
- GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
- Shipping Conditions:
- Blue Ice
