Mouse FABPL protein (Active)

Cannot supply to this region.

SKU:: ORB359273
Additional Names:: 14 kDa selenium-binding protein, Liver-type fatty acid-binding protein, L-FABP
Molecular Weight:: 14.2 kDa
Purity:: > 95% as determined by SDS-PAGE and HPLC.
Source:: E.Coli
Research Area:: Signal Transduction
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4, 2 % trehalose.
Format:: Lyophilized powder
Sequence:: MNFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVRNEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVYKRVSKRI