ORB359266
Human NGAL protein (Active)
Cannot supply to this region.
- SKU:
- ORB359266
- Additional Names:
- Lcn 2 protein, Lcn-2 protein, Lcn2 protein, Lipocalin-2 protein, Lipocalin 2 protein, Migration stimulating factor inhibitor protein, MSFI protein, Neutrophil gelatinase associated lipocalin protein, Neutrophil gelatinase associated lipocalin precursor protein, NGAL protein, Oncogene 24p3 protein, Oncogenic lipocalin 24p3 protein, Siderocalin protein, siderocalin LCN2 protein, SV40 induced 24P3 protein protein, Uterocalin protein, 25 kDa alpha 2 microglobulin related subunit of MMP9 protein, Alpha 2 microglobulin related protein protein, HNL protein
- Molecular Weight:
- 20.5 kDa
- Purity:
- > 95% as determined by SDS-PAGE and HPLC.
- Source:
- E.Coli
- Research Area:
- Cell Biology
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 μm filtered PBS, pH 7.4, with 0.05 % Tween-20
- Format:
- Lyophilized powder
- Sequence:
- QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
- Shipping Conditions:
- Blue Ice