ORB359254
Human TFF1 protein (Active)

Cannot supply to this region.
- SKU:
- ORB359254
- Additional Names:
- Breast cancer estrogen-inducible protein, Polypeptide P1.A, hP1.A, Protein pS2,
- Molecular Weight:
- 6.7 kDa
- Purity:
- > 97% as determined by SDS-PAGE and HPLC.
- Source:
- E.Coli
- Research Area:
- Signal Transduction
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 µm filtered 20 mM PB, pH 7.4, 150mM NaCl
- Format:
- Lyophilized powder
- Sequence:
- EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
- Shipping Conditions:
- Blue Ice
