ORB359165
Human IGF2 protein (Active)
Cannot supply to this region.
- SKU:
- ORB359165
- Additional Names:
- IGF-II, T3M-11-derived growth factor,
- Molecular Weight:
- 7.5 kDa
- Purity:
- > 98% as determined by SDS-PAGE and HPLC.
- Source:
- E.Coli
- Research Area:
- Metabolism Research
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, pH 8.0, 150 mM NaCl, with 0.02 % Tween-20
- Format:
- Lyophilized powder
- Sequence:
- AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
- Shipping Conditions:
- Blue Ice