Monkey IL8 protein (Active)

Cannot supply to this region.

SKU:: ORB359144
Additional Names:: 310C protein, 9E3 protein, AMCF1 protein, CEF-4 protein, chemokine, CXC motif, ligand 8 protein, CXC chemokine ligand 8 protein, CXC chemokine ligand 8 protein, CXCL 8 protein, Emoctakin protein, GCP 1 protein, GCP-1 protein, GCP1 protein, Granulocyte chemotactic protein 1 protein, IL 8 protein, IL8/NAP1 form I protein, Inteleukin 8 protein, Interleukin8 protein, K60 protein, LECT protein, LECT protein, LYNAP protein, MDNCF protein, Monocyte derived neutrophil activating peptide protein, NAF protein, NAP 1 protein, Neutrophil activating factor protein, Neutrophil activating factor protein, Neutrophil activating peptide 1 protein, SCYB8 protein, T-cell chemotactic factor protein, TSG1 protein
Molecular Weight:: 9.14 kDa
Purity:: > 95% as determined by SDS-PAGE and HPLC.
Source:: E.Coli
Research Area:: Immunology & Inflammation
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Format:: Lyophilized powder
Sequence:: AVLPRSAKELRCECIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKEPWVQRVVEKFVKRAENQNP