ORB359084
Human CCL27 protein (Active)
Cannot supply to this region.
- SKU:
- ORB359084
- Additional Names:
- CC chemokine ILC, CTACK, ESkine, IL-11 R-alpha-locus chemokine, Skinkine
- Molecular Weight:
- 10.1 kDa
- Purity:
- > 96% as determined by SDS-PAGE and HPLC.
- Source:
- E.Coli
- Research Area:
- Immunology & Inflammation
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 µm filtered PBS, pH 7.4
- Format:
- Lyophilized powder
- Sequence:
- FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
- Shipping Conditions:
- Blue Ice