ORB359079
Human CCL22 protein (Active)
Cannot supply to this region.
- SKU:
- ORB359079
- Additional Names:
- A 152E5.1 protein, ABCD 1 protein, C C motif chemokine 22 protein, CC chemokine STCP 1 protein, CC chemokine STCP-1 protein, ccl 22 protein, Ccl22 protein, CCL22_HUMAN protein, Chemokine (C C motif) ligand 22 protein, DCBCK protein, Macrophage-derived chemokine protein, MDC protein, Small inducible cytokine subfamily A member 22 protein, Small-inducible cytokine A22 protein, STCP 1 protein, Stimulated T cell chemotactic protein 1 protein
- Molecular Weight:
- 8.1 kDa
- Purity:
- > 97% as determined by SDS-PAGE and HPLC.
- Source:
- E.Coli
- Research Area:
- Immunology & Inflammation
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 µm filtered PBS, pH 7.4
- Format:
- Lyophilized powder
- Sequence:
- GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ
- Shipping Conditions:
- Blue Ice