Human CCL20 protein (Active)

Cannot supply to this region.

SKU:: ORB359077
Additional Names:: Beta-chemokine exodus-1, Liver and activation-regulated chemokine, Macrophage inflammatory protein 3 alpha, MIP-3-alpha, Small-inducible cytokine A20
Molecular Weight:: 8.0 kDa
Purity:: > 97% as determined by SDS-PAGE and HPLC.
Source:: E.Coli
Research Area:: Immunology & Inflammation
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: Lyophilized from a 0.2 μm filtered concentrated solution in 20 mM PB, pH 7.4, 100 mM NaCl.
Format:: Lyophilized powder
Sequence:: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM