ORB359075
Human CCL13 protein (Active)
Cannot supply to this region.
- SKU:
- ORB359075
- Additional Names:
- C-C motif chemokine 13 protein, CCL13 protein, CCL 13 protein, CCL13_HUMAN protein, Chemokine (C C motif) ligand 13 protein, CK beta 10 protein, CKb10 protein, MCP4 protein, MCP 4 protein, MCP-4 protein, Monocyte chemotactic protein 4 protein, NCC 1 protein, NCC-1 protein, NCC1 protein, New CC chemokine 1 protein, SCYA13 protein, SCYL1 protein, short chain protein, Small-inducible cytokine A13 protein
- Molecular Weight:
- 8.6 kDa
- Purity:
- > 96% as determined by SDS-PAGE and HPLC.
- Source:
- E.Coli
- Research Area:
- Immunology & Inflammation
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 µm filtered PBS, pH 7.4
- Format:
- Lyophilized powder
- Sequence:
- QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
- Shipping Conditions:
- Blue Ice