ORB359071
Human CCL5 protein (Active)
Cannot supply to this region.
- SKU:
- ORB359071
- Additional Names:
- Beta chemokine RANTES protein, C C motif chemokine 5 protein, CCL 5 protein, CCL5 protein, Chemokine (C C motif) ligand 5 protein, Chemokine CC Motif Ligand 5 protein, EoCP protein, Eosinophil chemotactic cytokine protein, MGC17164 protein, RANTES(4-68) protein, Regulated upon activation normally T expressed and presumably secreted protein, SCYA 5 protein, SCYA5 protein, SIS delta protein, Small inducible cytokine A5 (RANTES) protein, Small-inducible cytokine A5 protein, T cell specific protein p288 protein, T cell specific RANTES protein protein, TCP228 protein
- Molecular Weight:
- 7.8 kDa
- Purity:
- > 98% as determined by SDS-PAGE and HPLC.
- Source:
- E.Coli
- Research Area:
- Immunology & Inflammation
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, pH 7.4, 100 mM NaCl
- Format:
- Lyophilized powder
- Sequence:
- SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
- Shipping Conditions:
- Blue Ice