ORB359017
Mouse IL13 protein (Active)

Cannot supply to this region.
- SKU:
- ORB359017
- Additional Names:
- Allergic rhinitis protein, ALRH protein, BHR 1 protein, BHR-1 protein, BHR1 protein, IL 13 protein, IL-13 protein, IL13 protein, Interleukin 13 protein, Interleukin-13 protein, Interleukin13 protein, NC30 protein, P600 protein
- Molecular Weight:
- 12.3 kDa
- Purity:
- > 97% as determined by SDS-PAGE and HPLC.
- Source:
- E.Coli
- Research Area:
- Immunology & Inflammation
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 µm filtered PBS, pH 7.4
- Format:
- Lyophilized powder
- Sequence:
- M+PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
- Shipping Conditions:
- Blue Ice
