ORB359016
Mouse IL11 protein (Active)

Cannot supply to this region.
- SKU:
- ORB359016
- Additional Names:
- IL-11,
- Molecular Weight:
- 19.1 kDa
- Purity:
- > 97% as determined by SDS-PAGE and HPLC.
- Source:
- E.Coli
- Research Area:
- Immunology & Inflammation
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 µm filtered PBS, pH 7.4
- Format:
- Lyophilized powder
- Sequence:
- M+PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
- Shipping Conditions:
- Blue Ice
