ORB358999
Monkey IL6 protein (Active)

Cannot supply to this region.
- SKU:
- ORB358999
- Additional Names:
- Interleukin BSF 2 protein, B cell differentiation factor protein, B cell stimulatory factor 2 protein, BSF 2 protein, BSF-2 protein, BSF2 protein, CDF protein, CTL differentiation factor protein, Cytotoxic T cell differentiation factor protein, HGF protein, HPGF protein, HSF protein, Hybridoma growth factor protein, Hybridoma growth factor Interferon beta-2 protein, Hybridoma plasmacytoma growth factor protein, IFN-beta-2 protein, IFNB2 protein, IL 6 protein, IL-6 protein, IL6 protein, IL6 protein protein, Interferon beta 2 protein, Interferon beta-2 protein, Interleukin 6 (interferon beta 2) protein, Interleukin 6 protein, Interleukin BSF 2 protein, Interleukin-6 protein, Interleukin6 protein
- Molecular Weight:
- 21.1 kDa
- Purity:
- > 97% as determined by SDS-PAGE and HPLC.
- Source:
- E.Coli
- Research Area:
- Immunology & Inflammation
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 µm filtered concentrated solution in 50 mM Tris-HCl, pH 9.0, 600 mM NaCl, with 0.02 % Tween-20.
- Format:
- Lyophilized powder
- Sequence:
- M+APVLPGEDSKNVAAPHSQPLTSSERIDKHIRYILDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSNLRALRQM
- Shipping Conditions:
- Blue Ice
