ORB358997
Monkey IL1 alpha protein (Active)
Cannot supply to this region.
- SKU:
- ORB358997
- Additional Names:
- Hematopoietin 1 protein, Hematopoietin-1 protein, IL 1 alpha protein, IL 1 protein, IL 1A protein, IL-1 alpha protein, Il-1a protein, IL1 ALPHA protein, IL1 protein, IL1A protein, IL1A_HUMAN protein, IL1F1 protein, ilia protein, Interleukin 1 alpha protein, Interleukin 1 alpha precursor protein, Interleukin-1 alpha protein, Interleukin1 alpha protein, Preinterleukin 1 alpha protein, Pro interleukin 1 alpha protein
- Molecular Weight:
- 18.1 kDa
- Purity:
- > 97% as determined by SDS-PAGE and HPLC.
- Source:
- E.Coli
- Research Area:
- Immunology & Inflammation
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 µm filtered PBS, pH 7.4
- Format:
- Lyophilized powder
- Sequence:
- SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEINKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA
- Shipping Conditions:
- Blue Ice