Human IL36A protein (Active)

Cannot supply to this region.

SKU:: ORB358991
Additional Names:: FIL1 epsilon, IL-1 epsilon, Interleukin-1 family member 6, IL-1F6,
Molecular Weight:: 17.1 kDa
Purity:: > 95% as determined by SDS-PAGE and HPLC.
Source:: E.Coli
Research Area:: Immunology & Inflammation
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: Lyophilized from a 0.2 µm filtered 20 mM Tris, 300 mM NaCl, pH 8.0, 0.1 % Tween 80
Format:: Lyophilized powder
Sequence:: KIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF