Human C5a protein

Cannot supply to this region.

SKU:: ORB358910
Additional Names:: anaphylatoxin C5a analog protein, Anaphylatoxin C5a protein, C5a anaphylatoxin protein, C5a des Arg protein, Complement C5 alpha chain protein, Complement C5 protein, Complement component C5 protein, Complement component C5a protein, CPAMD4 protein
Molecular Weight:: 12.3 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: Mammalian cell
Research Area:: Signal Transduction
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR