Dog CGRP protein

Cannot supply to this region.

SKU:: ORB358731
Additional Names:: Alpha type CGRP protein, Beta type CGRP protein, CALC 1 protein, CALC A protein, CALC1 protein, CALC2 protein, CALCA protein, CALCB protein, Calcitonin 1 protein, Calcitonin 2 protein, CGRP protein, CGRP-I protein, CGRP I protein, CGRP-II protein, CGRP II protein, CGRP 1 protein, CGRP-1 protein, CGRP1 protein, CGRP 2 protein, CGRP-2 protein, CGRP2 protein, Katacalcin protein
Molecular Weight:: 19.4 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Cardiovascular Research
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: CSNLSTCVLGTYSKDLNNFHTFSGIGFGAETP