Mouse RANKL protein

Cannot supply to this region.

SKU:: ORB358674
Additional Names:: CD254 protein, hRANKL2 protein, ODF protein, OPGL protein, Osteoclast differentiation factor protein, Osteoprotegerin ligand protein, Receptor activator of nuclear factor kappa B ligand protein, Receptor activator of nuclear factor kappa-B ligand protein, TNF related activation induced cytokine protein, TNF-related activation-induced cytokine protein, TNFSF 11 protein, TNFSF11 protein, TRANCE protein, Tumor necrosis factor (ligand) superfamily member 11 protein, Tumor necrosis factor ligand superfamily member 11 protein, Tumor necrosis factor ligand superfamily member 11, soluble form protein
Molecular Weight:: 43.9 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Stem Cell & Developmental Biology
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: YFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Shipping Conditions:: Blue Ice