Mouse Cryopyrin protein

Cannot supply to this region.

SKU:: ORB358603
Additional Names:: AGTAVPRL protein, C1orf7 protein, Caterpiller protein 1.1 protein, CIAS 1 protein, CIAS1 protein, FCAS protein, FCU protein, MWS protein, NACHT protein, NALP 3 protein, NALP3 protein, NLRP3 protein, PYPAF 1 protein, PYPAF1 protein, PYRIN containing APAF1 like protein 1 protein
Molecular Weight:: 34.2 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Epigenetics, Immunology
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNAR